PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_14050.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 242aa    MW: 27596.6 Da    PI: 8.8488
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_14050.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151057148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd ll +++ ++G g W+ ++ +  ++R++k+c++rw++yl
  Rsa1.0_14050.1_g00002.1 10 KGAWTAEEDSLLRQCIDKYGEGKWHQVPLRAELNRCRKSCRLRWLNYL 57
                             79********************************************97 PP

2Myb_DNA-binding21.74.6e-0763101148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+   +E +ll++++k+lG++        ++ gRt++++k++w+++l
  Rsa1.0_14050.1_g00002.1  63 RGKLNSDEVDLLLRLHKLLGNR--------LP-GRTANDVKNYWNTHL 101
                              5677789999999999999999........**.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.666561IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-20559IPR009057Homeodomain-like
SuperFamilySSF466891.19E-21797IPR009057Homeodomain-like
SMARTSM007178.3E-14959IPR001005SANT/Myb domain
PfamPF002491.2E-141057IPR001005SANT/Myb domain
CDDcd001676.27E-101257No hitNo description
Gene3DG3DSA:1.10.10.605.6E-1260104IPR009057Homeodomain-like
PROSITE profilePS5129412.03962105IPR017930Myb domain
SMARTSM007171.3E-462103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEGSSKGLRK GAWTAEEDSL LRQCIDKYGE GKWHQVPLRA ELNRCRKSCR LRWLNYLKPS  60
IKRGKLNSDE VDLLLRLHKL LGNRLPGRTA NDVKNYWNTH LSKKHEPGCK TQMKKEKRNI  120
PCSSITLAQK IDVFKPRPRS FTVNNGCSHI IGMPKPDVVP LCLRFNNTKN VCENIATCNK  180
DDDKSELVCN LMDGQNMWWE SLLDESQDPA ALYPEATATK KAVTSEFDVD HLWSLLDGET  240
GT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1781045107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR7061950.0KR706195.1 Raphanus sativus cultivar Bordeaux anthocyanin regulator (MYB1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590812.11e-152PREDICTED: transcription factor MYB114-like
SwissprotQ9ZTC31e-109MYB90_ARATH; Transcription factor MYB90
TrEMBLA0A0H3XWN61e-161A0A0H3XWN6_RAPSA; Anthocyanin regulator
STRINGBra004162.1-P1e-149(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66390.11e-107myb domain protein 90